Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MBD6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 880-980 of human MBD6 (NP_443129.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MBD6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 880-980 of human MBD6 (NP_443129.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07380A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MBD6 |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Rat brain, Mouse brain, Mouse thymus, PC-3 |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 880-980 of human MBD6 (NP_443129.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGSRREPGRLALKWGTRGGFNGQMERSPRRTHHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARA | Uniprot ID | Q96DN6 |
Uniprot Id
Q96DN6
Target Species
Human
Target Name
MBD6
Target Full Name
Methyl-CpG-binding domain protein 6
Target Function
Binds to heterochromatin. Does not interact with either methylated or unmethylated DNA (in vitro).
Target Subcellular Location
Nucleus. Chromosome. Note=Associated with pericentric heterochromatin in about 25% of the cells.
Target Synonyms
MBD6; MBD6_HUMAN; Methyl-CpG-binding domain protein 6; Methyl-CpG-binding protein MBD6
Target Background
Enables chromatin binding activity. Located in chromocenter; fibrillar center; and nucleoplasm. Implicated in autism spectrum disorder.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
