-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIK3C2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PIK3C2A (NP_002636.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against PIK3C2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PIK3C2A (NP_002636.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-07757A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIK3C2A |
| Target Synonyms | CPK; OCSKD; PI3-K-C2A; PI3K-C2alpha; PI3K-C2-alpha; PI3-K-C2(ALPHA); PIK3C2A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, SK-OV-3 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PIK3C2A (NP_002636.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPL | Uniprot ID | O00443 |
Uniprot Id
O00443
Target Species
Human
Target Name
PIK3C2A
Target Full Name
Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
Target Function
Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) that act as second messengers. Has a role in several intracellular trafficking events. Functions in insulin signaling and secretion. Required for translocation of the glucose transporter SLC2A4/GLUT4 to the plasma membrane and glucose uptake in response to insulin-mediated RHOQ activation. Regulates insulin secretion through two different mechanisms: involved in glucose-induced insulin secretion downstream of insulin receptor in a pathway that involves AKT1 activation and TBC1D4/AS160 phosphorylation, and participates in the late step of insulin granule exocytosis probably in insulin granule fusion. Synthesizes PtdIns3P in response to insulin signaling. Functions in clathrin-coated endocytic vesicle formation and distribution. Regulates dynamin-independent endocytosis, probably by recruiting EEA1 to internalizing vesicles. In neurosecretory cells synthesizes PtdIns3P on large dense core vesicles. Participates in calcium induced contraction of vascular smooth muscle by regulating myosin light chain (MLC) phosphorylation through a mechanism involving Rho kinase-dependent phosphorylation of the MLCP-regulatory subunit MYPT1. May play a role in the EGF signaling cascade. May be involved in mitosis and UV-induced damage response. Required for maintenance of normal renal structure and function by supporting normal podocyte function. Involved in the regulation of ciliogenesis and trafficking of ciliary components
Target Subcellular Location
Cell membrane. Cytoplasmic vesicle, clathrin-coated vesicle. Nucleus. Cytoplasm. Golgi apparatus, trans-Golgi network.
Target Protein Families
PI3/PI4-kinase family
Target Tissue Specificity
Expressed in columnar and transitional epithelia, mononuclear cells, smooth muscle cells, and endothelial cells lining capillaries and small venules (at protein level). Ubiquitously expressed, with highest levels in heart, placenta and ovary, and lowest l
Target Synonyms
C2 containing phosphatidylinositol kinase; C2 domain containing alpha polypeptide; Class 2 alpha polypeptide; CPK; Cpk m; DKFZp686L193; MGC142218; OTTHUMP00000231763; P3C2A_HUMAN; Phosphatidylinositol 3 kinase class 2 alpha; Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha; Phosphoinositide 3 kinase class 2 alpha; Phosphoinositide 3 kinase; class 2; alpha polypeptide; Phosphoinositide 3-Kinase-C2-alpha; PI3-K-C2(ALPHA); PI3-K-C2A; PI3K-C2-alpha; PI3K-C2alpha; PI3KC 2 alpha; PIK3C 2A; Pik3c2a; PtdIns-3-kinase C2 subunit alpha
Notification