-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRMT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-433 of human PRMT2 (NP_001526.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRMT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-433 of human PRMT2 (NP_001526.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07896A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRMT2 |
| Target Synonyms | HRMT1L1; PRMT2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-433 of human PRMT2 (NP_001526.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR | Uniprot ID | P55345 |
Uniprot Id
P55345
Target Species
Human
Target Name
PRMT2
Target Full Name
Protein arginine N-methyltransferase 2
Target Function
Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.
Target Subcellular Location
[Isoform 1]: Cytoplasm. Nucleus. Note=Translocates from the cytoplasm to the nucleus, after hormone exposure. Excluded from nucleolus.; [Isoform PRMT2Alpha]: Nucleus. Note=Excluded from nucleolus.; [Isoform PRMT2Beta]: Cytoplasm. Nucleus. Nucleus, nucleolus.; [Isoform PRMT2Gamma]: Nucleus. Note=Excluded from nucleolus.; [Isoform PRMT2L2]: Cytoplasm. Nucleus. Note=Predominantly cytoplasmic.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, Protein arginine N-methyltransferase family
Target Tissue Specificity
Widely expressed. Highly expressed in androgen target organs such as heart, prostate, skeletal muscle, ovary and spinal cord.
Target Synonyms
ANM2_HUMAN; EC 2.1.1.; histone arginine N methyltransferase PRMT2; Histone-arginine N-methyltransferase PRMT2; HMT 1; HMT1 (hnRNP methyltransferase S. cerevisiae) like 1; HMT1; HMT1 hnRNP methyltransferase like 1; hnRNP methyltransferase (S. cerevisiae) like 1; hnRNP methyltransferase like 1; Hrmt1l1; MGC111373; PRMT 2; PRMT2 alpha; prmt2; PRMT2 beta; PRMT2 gamma; PRMT2 protein; PRMT2L2; Protein arginine methyltransferase 2; Protein arginine N methyltransferase 2; Protein arginine N-methyltransferase 2; Zf2
Target Background
Enables several functions, including nuclear receptor binding activity; peroxisome proliferator activated receptor binding activity; and protein homodimerization activity. Involved in several processes, including histone methylation; regulation of androgen receptor signaling pathway; and regulation of transcription, DNA-templated. Located in cytosol and nucleoplasm.
Notification