Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 49-162 of human IL15 (NP_000576.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 49-162 of human IL15 (NP_000576.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse heart, using IL15 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
| Cat.No | ADA-08257A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL15 |
| Target Synonyms | IL15; IL-15; interleukin-15 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 49-162 of human IL15 (NP_000576.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS | Uniprot ID | P40933 |
Uniprot Id
P40933
Target Species
Human
Target Name
IL15
Target Full Name
Interleukin-15
Target Function
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL15 requires interaction of IL15 with components of the IL2 receptor, including IL2RB and probably IL2RG but not IL2RA. In neutrophils, stimulates phagocytosis probably by signaling through the IL15 receptor, composed of the subunits IL15RA, IL2RB and IL2RG, which results in kinase SYK activation.
Target Subcellular Location
[Isoform IL15-S48AA]: Secreted.; [Isoform IL15-S21AA]: Cytoplasm. Nucleus. Note=IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components.
Target Protein Families
IL-15/IL-21 family
Target Tissue Specificity
Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.
Target Research Area
Immunology, Metabolism
Target Synonyms
IL 15; IL-15; IL15; IL15_HUMAN; Interleukin 15; Interleukin-15; Interleukin15; MGC9721
Target Background
The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
