-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMARCAD1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 928-1026 of human SMARCAD1(NP_064544.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SMARCAD1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 928-1026 of human SMARCAD1(NP_064544.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08396A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMARCAD1 |
| Target Synonyms | SMARCAD1; ADERM; BASNS; ETL1; HEL1; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, U-2 OS | Application | ELISA, WB |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 928-1026 of human SMARCAD1(NP_064544.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQDMTTVDEGDEGSMPADIATLLKTSMGL | Uniprot ID | Q9H4L7 |
Uniprot Id
Q9H4L7
Target Species
Human
Target Name
SMARCAD1
Target Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1
Target Function
DNA helicase that possesses intrinsic ATP-dependent nucleosome-remodeling activity and is both required for DNA repair and heterochromatin organization. Promotes DNA end resection of double-strand breaks (DSBs) following DNA damage: probably acts by weakening histone DNA interactions in nucleosomes flanking DSBs. Required for the restoration of heterochromatin organization after replication. Acts at replication sites to facilitate the maintenance of heterochromatin by directing H3 and H4 histones deacetylation, H3 'Lys-9' trimethylation (H3K9me3) and restoration of silencing.
Target Involvement
Adermatoglyphia (ADERM); Basan syndrome (BSNS)
Target Subcellular Location
Nucleus. Chromosome. Note=Colocalizes with PCNA at replication forks during S phase. Recruited to double-strand breaks (DSBs) sites of DNA damage.
Target Protein Families
SNF2/RAD54 helicase family
Target Tissue Specificity
Isoform 1 is expressed ubiquitously. Isoform 3 is expressed mainly in skin and esophagus. Expressed in fibroblasts and keratinocytes (at protein level).
Target Synonyms
ATP dependent helicase 1; ATP-dependent helicase 1; ETL1; hHEL1; Smarcad1; SMRCD_HUMAN; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1
Target Background
This gene encodes a member of the SNF subfamily of helicase proteins. The encoded protein plays a critical role in the restoration of heterochromatin organization and propagation of epigenetic patterns following DNA replication by mediating histone H3/H4 deacetylation. Mutations in this gene are associated with adermatoglyphia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification