-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPIF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-207 of human PPIF (NP_005720.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPIF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-207 of human PPIF (NP_005720.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08546A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPIF |
| Target Synonyms | CYP3; CypD; CyP-M; Cyp-D | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-207 of human PPIF (NP_005720.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS | Uniprot ID | P30405 |
Uniprot Id
P30405
Target Species
Human
Target Name
PPIF
Target Full Name
Peptidyl-prolyl cis-trans isomerase F, mitochondrial
Target Function
PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. Involved in regulation of the mitochondrial permeability transition pore (mPTP). It is proposed that its association with the mPTP is masking a binding site for inhibiting inorganic phosphate (Pi) and promotes the open probability of the mPTP leading to apoptosis or necrosis; the requirement of the PPIase activity for this function is debated. In cooperation with mitochondrial p53/TP53 is involved in activating oxidative stress-induced necrosis. Involved in modulation of mitochondrial membrane F(1)F(0) ATP synthase activity and regulation of mitochondrial matrix adenine nucleotide levels. Has anti-apoptotic activity independently of mPTP and in cooperation with BCL2 inhibits cytochrome c-dependent apoptosis.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Cyclophilin-type PPIase family
Target Synonyms
Cyclophilin 3; cyclophilin D; Cyclophilin F; Cyp D; CyP M; CyP-D; CyP-M; CYP3; CypD; hCyP3; mitochondrial; Mitochondrial cyclophilin; Peptidyl prolyl cis trans isomerase, mitochondral; Peptidyl-prolyl cis-trans isomerase F; Peptidyl-prolyl cis-trans isomerase F, mitochondrial; Peptidylprolyl isomerase F (cyclophilin F); Peptidylprolyl isomerase F; PPIase; PPIase F; Ppif; PPIF_HUMAN; Rotamase; Rotamase F
Target Background
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.
Notification