-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPFIBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 846-1005 of human PPFIBP1 (NP_003613.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPFIBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 846-1005 of human PPFIBP1 (NP_003613.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08736A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPFIBP1 |
| Target Synonyms | L2; SGT2; hSGT2; hSgt2p; NEDSMBA; PPFIBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-375, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 846-1005 of human PPFIBP1 (NP_003613.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVKPKKLAFSNFGNLRKKKQEDGEEYVCPMELGQASGSASKKGFKPGLDMRLYEEDDLDRLEQMEDSEGTVRQIGAFSEGINNLTHMLKEDDMFKDFAARSPSASITDEDSNV | Uniprot ID | Q86W92 |
Uniprot Id
Q86W92
Target Species
Human
Target Name
PPFIBP1
Target Full Name
Liprin-beta-1
Target Function
May regulate the disassembly of focal adhesions. Did not bind receptor-like tyrosine phosphatases type 2A.
Target Protein Families
Liprin family, Liprin-beta subfamily
Target Tissue Specificity
Widely expressed. Absent in liver.
Target Synonyms
PPFIBP 1; hSGT2; hSgt2p; KIAA1230; L2; LIPB1_HUMAN; Liprin beta 1; liprin related protein; Liprin-beta-1; PPFIBP1; Protein tyrosine phosphatase receptor type f polypeptide interacting protein binding protein 1; Protein tyrosine phosphatase receptor type f polypeptide-interacting protein-binding protein 1; PTPRF interacting protein binding protein 1; PTPRF interacting protein; binding protein 1 (liprin beta 1); PTPRF-interacting protein-binding protein 1; SGT2
Target Background
The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Notification