-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Septin 9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Septin 9 (NP_001106964.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Septin 9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Septin 9 (NP_001106964.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08950A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Septin 9 |
| Target Synonyms | MSF; MSF1; NAPB; SEPT9; SINT1; PNUTL4; SeptD1; AF17q25; Septin 9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Septin 9 (NP_001106964.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPV | Uniprot ID | Q9UHD8 |
Uniprot Id
Q9UHD8
Target Species
Human
Target Name
SEPT9
Target Full Name
Septin-9
Target Function
Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). May play a role in the internalization of 2 intracellular microbial pathogens, Listeria monocytogenes and Shigella flexneri.
Target Involvement
Hereditary neuralgic amyotrophy (HNA)
Target Subcellular Location
Cytoplasm, cytoskeleton. Note=In an epithelial cell line, concentrates at cell-cell contact areas. After TGF-beta1 treatment and induction of epithelial to mesenchymal transition, colocalizes partly with actin stress fibers. During bacterial infection, displays a collar shape structure next to actin at the pole of invading bacteria.
Target Protein Families
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, Septin GTPase family
Target Tissue Specificity
Widely expressed. Isoforms are differentially expressed in testes, kidney, liver heart, spleen, brain, peripheral blood leukocytes, skeletal muscle and kidney. Specific isoforms appear to demonstrate tissue specificity. Isoform 5 is the most highly expres
Target Synonyms
AF17q25; Cell division control protein septin D1; KIAA0991; MLL septin like fusion protein; MLL septin-like fusion protein; MLL septin-like fusion protein MSF-A; MSF; MSF1; NAPB; Ov/Br septin; Ovarian/breast septin alpha; Ovarian/Breast septin; PNUTL4; SEPT9; SEPT9_HUMAN; SeptD1; Septin 9; Septin D1; Septin-9; SINT1
Target Background
This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.
Notification