Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSPAN4/NAG-2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TSPAN4/NAG-2 (NP_003262.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TSPAN4/NAG-2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TSPAN4/NAG-2 (NP_003262.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09019A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSPAN4/NAG-2 |
| Target Synonyms | NAG2; NAG-2; TM4SF7; TSPAN-4; TETRASPAN; TSPAN4/NAG-2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Mouse lung, PC-3, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TSPAN4/NAG-2 (NP_003262.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQE | Uniprot ID | O14817 |
Uniprot Id
O14817
Target Species
Human
Target Name
TSPAN4
Target Full Name
Tetraspanin-4
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Tetraspanin (TM4SF) family
Target Tissue Specificity
Expressed in multiple tissues but is absent in brain, lymphoid cells, and platelets.
Target Synonyms
TSPAN4; NAG2; TM4SF7; Tetraspanin-4; Tspan-4; Novel antigen 2; NAG-2; Transmembrane 4 superfamily member 7
Target Background
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
