-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GREM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-143 of human GREM1 (NP_001178252.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GREM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-143 of human GREM1 (NP_001178252.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09197A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GREM1 |
| Target Synonyms | DRM; HMPS; MPSH; PIG2; CRAC1; CRCS4; DAND2; HMPS1; IHG-2; DUP15q; C15DUPq; GREMLIN; CKTSF1B1; GREM1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, HT-29, LO2, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 44-143 of human GREM1 (NP_001178252.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD | Uniprot ID | O60565 |
Uniprot Id
O60565
Target Species
Human
Target Name
GREM1
Target Full Name
Gremlin-1
Target Function
Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signaling in a dose-dependent manner. Antagonist of BMP2; inhibits BMP2-mediated differentiation of osteoblasts (in vitro). Acts as inhibitor of monocyte chemotaxis. Can inhibit the growth or viability of normal cells but not transformed cells when is overexpressed.
Target Involvement
Polyposis syndrome, mixed hereditary 1 (HMPS1)
Target Subcellular Location
Secreted.
Target Protein Families
DAN family
Target Tissue Specificity
Highly expressed in small intestine, fetal brain and colon. Expression is restricted to intestinal subepithelial myofibroblasts (ISEMFs) at the crypt base. In subjects with HMPS1, by contrast, GREM1 is expressed, not only in basal ISEMFs, but also at very
Target Synonyms
BMP antagonist 1; Cell proliferation inducing gene 2 protein; Cell proliferation-inducing gene 2 protein; CKTSF1B1; colorectal adenoma and carcinoma 1; Cysteine knot superfamily 1; Cysteine knot superfamily 1; BMP antagonist 1; Cysteine knot superfamily BMP antagonist 1; DAN domain family member 2; DAND2; Down regulated in Mos-transformed cells protein; Down-regulated in Mos-transformed cells protein; DRM; grem1; GREM1_HUMAN; Gremlin 1 homolog; cysteine knot superfamily; Gremlin 1 like protein; Gremlin 1; cysteine knot superfamily; homolog; GREMLIN; Gremlin-1; Gremlin1; IHG-2; IHG2; Increased in high glucose 2; Increased in high glucose protein 2; PIG2; Proliferation inducing gene 2; proliferation inducing gene 2 protein
Target Background
This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to relay the sonic hedgehog (SHH) signal from the polarizing region to the apical ectodermal ridge during limb bud outgrowth. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification