-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSMB8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 163-272 of human PSMB8 (NP_004150.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PSMB8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 163-272 of human PSMB8 (NP_004150.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09341A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSMB8 |
| Target Synonyms | JMP; ALDD; LMP7; NKJO; D6S216; PRAAS1; PSMB5i; RING10; D6S216E; PSMB8 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse liver, Mouse spleen | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 163-272 of human PSMB8 (NP_004150.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYR | Uniprot ID | P28062 |
Uniprot Id
P28062
Target Species
Human
Target Name
PSMB8
Target Full Name
Proteasome subunit beta type-8
Target Function
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Involved in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein. Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency. Required for the differentiation of preadipocytes into adipocytes.
Target Involvement
Nakajo syndrome (NKJO)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Peptidase T1B family
Target Research Area
Cell Biology
Target Synonyms
ALDD; D6S216; D6S216E; Large multifunctional peptidase 7; Large multifunctional protease 7; LMP 7; LMP7; Low molecular mass protein 7; Low molecular weight protein 7; Macropain subunit C13; MGC1491; Multicatalytic endopeptidase complex subunit C13; NKJO; OTTHUMP00000062981; Protease component C13; Proteasome (prosome macropain) subunit beta type 8; Proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7); Proteasome beta 8 subunit; Proteasome catalytic subunit 3i; Proteasome component C13; Proteasome related gene 7; Proteasome subunit beta 5i; Proteasome subunit beta 8; Proteasome subunit beta type 8; Proteasome subunit beta type; Proteasome subunit beta type-8; Proteasome subunit beta-5i; Proteasome subunit Y2; PSB8_HUMAN; PSMB 8; PSMB5i; PSMB8; Really interesting new gene 10 protein; RING 10; RING10; Y2
Target Background
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit.
Notification