-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NCAPG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 610-700 of human NCAPG (NP_071741.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NCAPG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 610-700 of human NCAPG (NP_071741.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09583A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NCAPG |
| Target Synonyms | CAPG; CHCG; YCG1; NY-MEL-3; NCAPG | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 610-700 of human NCAPG (NP_071741.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CCGLQNQDFARKHFVLLLQVLQIDDVTIKISALKAIFDQLMTFGIEPFKTKKIKTLHCEGTEINSDDEQESKEVEETATAKNVLKLLSDFL | Uniprot ID | Q9BPX3 |
Uniprot Id
Q9BPX3
Target Species
Human
Target Name
NCAPG
Target Full Name
Condensin complex subunit 3
Target Function
Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.
Target Subcellular Location
Nucleus. Cytoplasm. Chromosome. Note=In interphase cells, the majority of the condensin complex is found in the cytoplasm, while a minority of the complex is associated with chromatin. A subpopulation of the complex however remains associated with chromosome foci in interphase cells. During mitosis, most of the condensin complex is associated with the chromatin. At the onset of prophase, the regulatory subunits of the complex are phosphorylated by CDK1, leading to condensin's association with chromosome arms and to chromosome condensation. Dissociation from chromosomes is observed in late telophase.
Target Protein Families
CND3 (condensin subunit 3) family
Target Tissue Specificity
Highly expressed in testis.
Target Synonyms
CAPG; CHCG; Chromosome associated protein G; Chromosome condensation protein G; Chromosome-associated protein G; CND3_HUMAN; Condensin complex subunit 3; Condensin subunit CAP G; Condensin subunit CAP-G; HCAP G; hCAP-G; Melanoma antigen NY MEL 3; Melanoma antigen NY-MEL-3; NCAPG; Non SMC condensin I complex subunit G; Non-SMC condensin I complex subunit G; NY MEL 3; XCAP G homolog; XCAP-G homolog
Target Background
This gene encodes a subunit of the condensin complex, which is responsible for the condensation and stabilization of chromosomes during mitosis and meiosis. Phosphorylation of the encoded protein activates the condensin complex. There are pseudogenes for this gene on chromosomes 8 and 15. Alternative splicing results in multiple transcript variants.
Notification