Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human MYL4 (NP_002467.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human MYL4 (NP_002467.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09597A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYL4 |
| Target Synonyms | GT1; ALC1; AMLC; PRO1957; MYL4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Mouse lung, Mouse testis, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human MYL4 (NP_002467.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG | Uniprot ID | P12829 |
Uniprot Id
P12829
Target Species
Human
Target Name
MYL4
Target Full Name
Myosin light chain 4
Target Function
Regulatory light chain of myosin. Does not bind calcium.
Target Involvement
Atrial fibrillation, familial, 18 (ATFB18)
Target Synonyms
ALC 1; ALC1; AMLC; Atrial/embryonic alkali myosin light chain; embryonic muscle/atrial isoform; GT 1; GT1; MLC 1; MLC1; MYL 4; Myl4; MYL4_HUMAN; Myosin atrial/fetal muscle light chain; Myosin light chain 1; Myosin light chain 1 embryonic muscle/atrial isoform; Myosin light chain 4 alkali atrial embryonic; Myosin light chain 4; Myosin light chain alkali GT 1 isoform; Myosin light chain alkali GT-1 isoform; Myosin light polypeptide 4 alkali atrial embryonic; Myosin light polypeptide 4; PRO1957
Target Background
Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
