-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Myelin oligodendrocyte glycoprotein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-154 of human Myelin oligodendrocyte glycoprotein (NP_996532.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Myelin oligodendrocyte glycoprotein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-154 of human Myelin oligodendrocyte glycoprotein (NP_996532.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09707A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Myelin oligodendrocyte glycoprotein |
| Target Synonyms | BTN6; BTNL11; MOGIG2; NRCLP7; Myelin oligodendrocyte glycoprotein | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-154 of human Myelin oligodendrocyte glycoprotein (NP_996532.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG | Uniprot ID | Q16653 |
Uniprot Id
Q16653
Target Species
Human
Target Name
MOG
Target Full Name
Myelin-oligodendrocyte glycoprotein
Target Function
Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.; (Microbial infection) Acts as a receptor for rubella virus.
Target Involvement
Narcolepsy 7 (NRCLP7)
Target Subcellular Location
[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 5]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell membrane; Single-pass type I membrane protein.; [Isoform 4]: Cell membrane; Single-pass type I membrane protein.; [Isoform 6]: Cell membrane; Single-pass type I membrane protein.; [Isoform 7]: Cell membrane; Single-pass type I membrane protein.; [Isoform 8]: Cell membrane; Single-pass type I membrane protein.; [Isoform 9]: Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, BTN/MOG family
Target Tissue Specificity
Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.
Target Research Area
Signal Transduction
Target Synonyms
BTN6; BTNL11; MGC26137; MOG alpha 5; MOG alpha 6; MOG AluA; MOG AluB; MOG; MOG Ig AluB; MOG_HUMAN; MOGIG2; Myelin oligodendrocyte glycoprotein; Myelin-oligodendrocyte glycoprotein; NRCLP7
Target Background
The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification