Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SAT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-171 of human SAT1 (NP_002961.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SAT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-171 of human SAT1 (NP_002961.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from Mouse placenta, using SAT1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-09877A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SAT1 |
| Target Synonyms | SAT; DC21; KFSD; SSAT; KFSDX; SSAT-1; SAT1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse placenta | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-171 of human SAT1 (NP_002961.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE | Uniprot ID | P21673 |
Uniprot Id
P21673
Target Species
Human
Target Name
SAT1
Target Full Name
Diamine acetyltransferase 1
Target Function
Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Acts on 1,3-diaminopropane, 1,5-diaminopentane, putrescine, spermidine (forming N(1)- and N(8)-acetylspermidine), spermine, N(1)-acetylspermidine and N(8)-acetylspermidine.
Target Involvement
Keratosis follicularis spinulosa decalvans X-linked (KFSDX)
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Acetyltransferase family
Target Research Area
Metabolism
Target Synonyms
DC21; Diamine acetyltransferase 1; Diamine N acetyltransferase 1; EC 2.3.1.57; KFSD; KFSDX; Polyamine N acetyltransferase 1; Polyamine N-acetyltransferase 1; Putrescine acetyltransferase; SAT; SAT1; SAT1_HUMAN; Spermidine/spermine N(1) acetyltransferase 1; Spermidine/spermine N(1)-acetyltransferase 1; Spermidine/spermine N1 acetyltransferase 1; Spermidine/spermine N1 acetyltransferase alpha; SSAT 1; SSAT; SSAT-1
Target Background
The protein encoded by this gene belongs to the acetyltransferase family, and is a rate-limiting enzyme in the catabolic pathway of polyamine metabolism. It catalyzes the acetylation of spermidine and spermine, and is involved in the regulation of the intracellular concentration of polyamines and their transport out of cells. Defects in this gene are associated with keratosis follicularis spinulosa decalvans (KFSD). Alternatively spliced transcripts have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
