-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ORC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 458-577 of human ORC2 (NP_006181.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ORC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 458-577 of human ORC2 (NP_006181.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10068A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ORC2 |
| Target Synonyms | ORC2L; ORC2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 458-577 of human ORC2 (NP_006181.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA | Uniprot ID | Q13416 |
Uniprot Id
Q13416
Target Species
Human
Target Name
ORC2
Target Full Name
Origin recognition complex subunit 2
Target Function
Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Binds histone H3 and H4 trimethylation marks H3K9me3, H3K20me3 and H4K27me3. Stabilizes LRWD1, by protecting it from ubiquitin-mediated proteasomal degradation. Also stabilizes ORC3.
Target Subcellular Location
Nucleus.
Target Protein Families
ORC2 family
Target Synonyms
orc2; ORC2_HUMAN; ORC2L; Origin of replication 2 (yeast homolog) like; Origin recognition complex protein 2 homolog; Origin recognition complex subunit 2; Origin recognition complex subunit 2 isoform B; Origin recognition complex subunit 2 like (yeast); Origin recognition complex, subunit 2 homolog; Origin recognition complex, subunit 2, S. cerevisiae, homolog of; Origin recognition complex, subunit 2-like (S. cerevisiae)
Target Background
The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. This protein forms a core complex with ORC3, -4, and -5. It also interacts with CDC45 and MCM10, which are proteins known to be important for the initiation of DNA replication. This protein has been demonstrated to specifically associate with the origin of replication of Epstein-Barr virus in human cells, and is thought to be required for DNA replication from viral origin of replication. Alternatively spliced transcript variants have been found, one of which is a nonsense-mediated mRNA decay candidate.
Notification