Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZDHHC18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-388 of human ZDHHC18 (NP_115659.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ZDHHC18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-388 of human ZDHHC18 (NP_115659.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10126A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZDHHC18 |
| Target Synonyms | DHHC18; DHHC-18; ZDHHC18 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain, Raji | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 301-388 of human ZDHHC18 (NP_115659.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQSDTVLPSPIRSDEPACRAKPDASMVGGHP | Uniprot ID | Q9NUE0 |
Uniprot Id
Q9NUE0
Target Species
Human
Target Name
ZDHHC18
Target Full Name
Palmitoyltransferase ZDHHC18
Target Function
Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates. Palmitoylates HRAS and LCK. May also have a palmitoyltransferase activity toward the beta-2 adrenergic receptor/ADRB2 and therefore regulate G protein-coupled receptor signaling.
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
ZDHHC18; Palmitoyltransferase ZDHHC18; DHHC domain-containing cysteine-rich protein 18; DHHC-18; Zinc finger DHHC domain-containing protein 18
Target Background
Enables palmitoyltransferase activity. Involved in peptidyl-L-cysteine S-palmitoylation. Located in Golgi apparatus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
