-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CST1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-141 of human CST1 (NP_001889.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CST1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-141 of human CST1 (NP_001889.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11093A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CST1 |
| Target Synonyms | CST1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, A-549, BT-474, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-141 of human CST1 (NP_001889.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES | Uniprot ID | P01037 |
Uniprot Id
P01037
Target Species
Human
Target Name
CST1
Target Full Name
Cystatin-SN
Target Function
Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well.
Target Subcellular Location
Secreted.
Target Protein Families
Cystatin family
Target Tissue Specificity
Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid.
Target Synonyms
CST1; Cystain SAI; Cystain-SA-I; Cystatin 1; Cystatin-1; Cystatin-SN; Cystatin1; Cysteine proteinase inhibitor, type 2 family; CYTN; CYTN_HUMAN; Salivary cystatin SA1; Salivary cystatin-SA-1
Target Background
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid.
Notification