-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CXCR3-B was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-100 human CXCR3-B(NP_001136269.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CXCR3-B was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-100 human CXCR3-B(NP_001136269.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08460A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CXCR3-B |
| Target Synonyms | GPR9; MigR; CD182; CD183; Mig-R; CKR-L2; CMKAR3; IP10-R; CXCR3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 1-100 human CXCR3-B(NP_001136269.1). | Immunogen Sequence | MELRKYGPGRLAGTVIGGAAQSKSQTKSDSITKEFLPGLYTAPSSPFPPSQVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR |
|---|---|---|---|
| Uniprot ID | P49682-2 |
Uniprot Id
P49682
Target Species
Human
Target Name
CXCR3
Target Full Name
C-X-C chemokine receptor type 3
Target Function
Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway. Binds to CCL21. Probably promotes cell chemotaxis response.; Receptor for the C-X-C chemokine CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the proliferation, survival and angiogenic activity of human microvascular endothelial cells (HMVEC) through a cAMP-mediated signaling pathway. Does not promote cell chemotaxis respons. Interaction with CXCL4 or CXCL10 leads to activation of the p38MAPK pathway and contributes to inhibition of angiogenesis. Overexpression in renal cancer cells down-regulates expression of the anti-apoptotic protein HMOX1 and promotes apoptosis.; Mediates the activity of CXCL11.
Target Subcellular Location
[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta. Isoform 2 is expressed in endothelial cells. Expressed in T-cells (at protein level).
Target Research Area
Cardiovascular
Target Synonyms
CXCR3; GPR9; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; CKR-L2; G protein-coupled receptor 9; Interferon-inducible protein 10 receptor; IP-10 receptor; CD antigen CD183
Target Background
This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716).
Notification