-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eRF3A/GSPT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of eRF3A/GSPT1 (NP_001123479.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against eRF3A/GSPT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of eRF3A/GSPT1 (NP_001123479.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15773A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | eRF3A/GSPT1 |
| Target Synonyms | GST1; ETF3A; eRF3a; 551G9.2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of eRF3A/GSPT1 (NP_001123479.1). | Immunogen Sequence | MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGM |
|---|---|---|---|
| Uniprot ID | P15170 |
Uniprot Id
P15170
Target Species
Human
Target Name
GSPT1
Target Full Name
Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
Target Function
Involved in translation termination in response to the termination codons UAA, UAG and UGA. Stimulates the activity of ETF1. Involved in regulation of mammalian cell growth. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Required for SHFL-mediated translation termination which inhibits programmed ribosomal frameshifting (-1PRF) of mRNA from viruses and cellular genes.
Target Protein Families
TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, ERF3 subfamily
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
GSPT1; ERF3AEukaryotic peptide chain release factor GTP-binding subunit ERF3A; Eukaryotic peptide chain release factor subunit 3a; eRF3a; G1 to S phase transition protein 1 homolog
Target Background
Enables translation release factor activity. Involved in regulation of translational termination. Acts upstream of or within protein methylation. Predicted to be located in cytosol. Predicted to be part of translation release factor complex.
Notification