-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EXT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human EXT1(NP_000118.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EXT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human EXT1(NP_000118.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08031A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EXT1 |
| Target Synonyms | EXT; LGS; TTV; LGCR; TRPS2; EXT1 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human EXT1(NP_000118.2). | Immunogen Sequence | HGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQDK |
|---|---|---|---|
| Uniprot ID | Q16394 |
Uniprot Id
Q16394
Target Species
Human
Target Name
EXT1
Target Full Name
Exostosin-1
Target Function
Glycosyltransferase required for the biosynthesis of heparan-sulfate. The EXT1/EXT2 complex possesses substantially higher glycosyltransferase activity than EXT1 or EXT2 alone. Appears to be a tumor suppressor. Required for the exosomal release of SDCBP, CD63 and syndecan.
Target Involvement
Hereditary multiple exostoses 1 (EXT1); Tricho-rhino-phalangeal syndrome 2 (TRPS2); Chondrosarcoma (CHDSA)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein. Golgi apparatus membrane; Single-pass type II membrane protein. Note=The EXT1/EXT2 complex is localized in the Golgi apparatus.
Target Protein Families
Glycosyltransferase 47 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
4-alpha-N-acetylglucosaminyltransferase; exostoses (multiple) 1; Exostosin 1; Exostosin glycosyltransferase 1; Exostosin-1; EXT; EXT1; EXT1_HUMAN; Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan; Langer-Giedion syndrome chromosome region; LGCR; LGS; Multiple exostoses protein 1; Multiple exostoses protein 1 homolog ; N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase; Putative tumor suppressor protein EXT1; TRPS2; TTV
Target Background
This gene encodes an endoplasmic reticulum-resident type II transmembrane glycosyltransferase involved in the chain elongation step of heparan sulfate biosynthesis. Mutations in this gene cause the type I form of multiple exostoses.
Notification