-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GTF2F1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-517 of GTF2F1 (NP_002087.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GTF2F1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-517 of GTF2F1 (NP_002087.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07261A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GTF2F1 |
| Target Synonyms | BTF4; RAP74; TF2F1; TFIIF; GTF2F1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Jurkat, K-562, Mouse brain, Mouse liver, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 390-517 of GTF2F1 (NP_002087.2). | Immunogen Sequence | PSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE |
|---|---|---|---|
| Uniprot ID | P35269 |
Uniprot Id
P35269
Target Species
Human
Target Name
GTF2F1
Target Full Name
General transcription factor IIF subunit 1
Target Function
TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.
Target Subcellular Location
Nucleus.
Target Protein Families
TFIIF alpha subunit family
Target Synonyms
2810405L04Rik; BTF4; C76800; General transcription factor IIF 74 kDa subunit; General transcription factor IIF subunit 1; General transcription factor IIF; polypeptide 1; 74kDa; Gtf2f1; MGC94148; OTTHUMP00000237859; RAP74; T2FA_HUMAN; TF2F1; TFIIF; TFIIF-alpha; Transcription initiation factor IIF subunit alpha; Transcription initiation factor RAP74
Target Background
Enables several functions, including RNA polymerase II general transcription initiation factor activity; phosphatase activator activity; and promoter-specific chromatin binding activity. Involved in several processes, including positive regulation of transcription by RNA polymerase II; response to virus; and transcription initiation from RNA polymerase II promoter. Located in cell junction and nucleoplasm. Part of transcription factor TFIID complex.
Notification