-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against 14-3-3 sigma was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 sigma (P31947) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against 14-3-3 sigma was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 sigma (P31947) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13853A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 14-3-3 sigma |
| Target Synonyms | YWHAS; 14-3-3 sigma | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-431, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 sigma (P31947). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL | Uniprot ID | P31947 |
Uniprot Id
P31947
Target Species
Human
Target Name
SFN
Target Full Name
14-3-3 protein sigma
Target Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.; p53-regulated inhibitor of G2/M progression.
Target Subcellular Location
Cytoplasm. Nucleus. Secreted. Note=May be secreted by a non-classical secretory pathway.
Target Protein Families
14-3-3 family
Target Tissue Specificity
Present mainly in tissues enriched in stratified squamous keratinizing epithelium.
Target Research Area
Neuroscience
Target Synonyms
14 3 3 protein sigma; 14-3-3 protein sigma; 1433S_HUMAN; Epithelial cell marker protein 1; Er; HME 1; HME1; MGC143283; Mkrn3; Mme1; OTTHUMP00000004242; RP23 137L22.11; SFN; SFN protein; Stratifin; YWHAS
Target Background
This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis.
Notification