Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2162-2261 of human ABCA1 (NP_005493.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against ABCA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2162-2261 of human ABCA1 (NP_005493.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of?ABCA1 in paraffin-embedded?human lung cancer tissue using?ABCA1 Rabbit pAb at a dilution of 1:100 (40x lens).?High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Cat.No | ADA-08474A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCA1 |
| Target Synonyms | TGD; ABC1; CERP; ABC-1; HDLDT1; HPALP1; HDLCQTL13; ABCA1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2162-2261 of human ABCA1 (NP_005493.2?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDDHLKDLSLHKNQTVVDVAVLTSFLQDEKVKESYV | Uniprot ID | O95477 |
Uniprot Id
O95477
Target Species
Human
Target Name
ABCA1
Target Full Name
Phospholipid-transporting ATPase ABCA1
Target Function
Catalyzes the translocation of specific phospholipids from the cytoplasmic to the extracellular/lumenal leaflet of membrane coupled to the hydrolysis of ATP. Thereby, participates in phospholipid transfer to apoliproteins to form nascent high density lipoproteins/HDLs. Transports preferentially phosphatidylcholine over phosphatidylserine. May play a similar role in the efflux of intracellular cholesterol to apoliproteins and the formation of nascent high density lipoproteins/HDLs.
Target Involvement
High density lipoprotein deficiency 1 (HDLD1); High density lipoprotein deficiency 2 (HDLD2)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome.
Target Protein Families
ABC transporter superfamily, ABCA family
Target Tissue Specificity
Widely expressed, but most abundant in macrophages.
Target Synonyms
ABC 1; ABC Transporter 1; ABC-1; ABC1; ABCA 1; ABCA1; ABCA1_HUMAN; ATP binding Cassette 1; ATP binding cassette sub family A ABC1 member 1; ATP binding cassette sub family A member 1; ATP binding Cassette Transporter 1; ATP-binding cassette 1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; CERP; Cholesterol efflux regulatory protein; FLJ14958; HDLDT1; Membrane bound; MGC164864; MGC165011; TD; TGD
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
