-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 690-828 of human ABCA6 (NP_525023.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABCA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 690-828 of human ABCA6 (NP_525023.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07858A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCA6 |
| Target Synonyms | EST155051; ABCA6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 690-828 of human ABCA6 (NP_525023.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLKCAGSSMFLKRRWGLGYHLSLHRNEICNPEQITSFITHHIPDAKLKTENKEKLVYTLPLERTNTFPDLFSDLDKCSDQGVTGYDISMSTLNEVFMKLEGQSTIEQDFEQVEMIRDSESLNEMELAHSSFSEMQTAVS | Uniprot ID | Q8N139 |
Uniprot Id
Q8N139
Target Species
Human
Target Name
ABCA6
Target Full Name
ATP-binding cassette sub-family A member 6
Target Function
Probable transporter which may play a role in macrophage lipid transport and homeostasis.
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
ABC transporter superfamily, ABCA family
Target Tissue Specificity
Widely expressed with higher expression in liver.
Target Synonyms
ABC transporter ABCA6; ABCA 6; ABCA6; ABCA6_HUMAN; ATP binding cassette A6; ATP binding cassette sub family A (ABC1) member 6; ATP binding cassette sub family A member 6; ATP-binding cassette sub-family A member 6; EST155051; FLJ43498
Target Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis.
Notification