Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABTB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ABTB1 (NP_742024.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABTB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ABTB1 (NP_742024.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07304A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABTB1 |
| Target Synonyms | BPOZ; BTB3; BTBD21; EF1ABP; PP2259; ABTB1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ABTB1 (NP_742024.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGARCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFVVHGKPFRVHRCVLGARSAYF | Uniprot ID | Q969K4 |
Uniprot Id
Q969K4
Target Species
Human
Target Name
ABTB1
Target Full Name
Ankyrin repeat and BTB/POZ domain-containing protein 1
Target Function
May act as a mediator of the PTEN growth-suppressive signaling pathway. May play a role in developmental processes.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Ubiquitously expressed in all fetal tissues examined including heart, brain, liver, and kidney. Also expressed at lower levels in both adult heart and hypertrophic heart.
Target Synonyms
ABTB 1; Abtb1; ABTB1_HUMAN; Ankyrin repeat and BTB (POZ) domain containing 1; Ankyrin repeat and BTB/POZ domain containing 1; Ankyrin repeat and BTB/POZ domain containing protein 1; Ankyrin repeat and BTB/POZ domain-containing protein 1; EF1ABP; Elongation factor 1A binding protein; Elongation factor 1A-binding protein; MGC20585; PP 2259; PP2259
Target Background
This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
