Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human ACAP2 (NP_036419.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ACAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human ACAP2 (NP_036419.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02184A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACAP2 |
| Target Synonyms | CENTB2; CNT-B2; ACAP2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Jurkat, LO2, Mouse brain, Mouse liver, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human ACAP2 (NP_036419.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILT | Uniprot ID | Q15057 |
Uniprot Id
Q15057
Target Species
Human
Target Name
ACAP2
Target Full Name
Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
Target Function
GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6).
Target Subcellular Location
Endosome membrane; Peripheral membrane protein.
Target Tissue Specificity
Widely expressed. Highest level in lung.
Target Synonyms
ACAP 2; ACAP2; ACAP2_HUMAN; ANK repeat and PH domain-containing protein 2; Arf GAP with coiled coil ANK repeat and PH domain containing protein 2; Arf GAP with coiled coil ANK repeat and PH domains 2; Arf-GAP with coiled-coil; ArfGAP with coiled coil ankyrin repeat and PH domains 2; CENT B 2; Centaurin beta2; Centaurin-beta-2; CENTB 2; CENTB2; Cnt b2; Cnt-b2; Cntb2; KIAA0041; Similar to yeast ZINC FINGER PROTEIN GCS1
Target Background
Enables GTPase activator activity. Acts upstream of or within actin filament-based process. Located in ruffle.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
