-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Acetyl-Histone H4-K5 was raised in Rabbit using a synthetic acetylated peptide around K5 of human Histone H4 (P62805) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA, DB.
The antibody against Acetyl-Histone H4-K5 was raised in Rabbit using a synthetic acetylated peptide around K5 of human Histone H4 (P62805) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA, DB.
| Cat.No | ADA-15891A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Acetyl-Histone H4-K5 |
| Target Synonyms | H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4; Acetyl-Histone H4-K5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6 TSA, HeLa TSA, NIH/3T3 TSA | Application | ELISA, WB, DB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic acetylated peptide around K5 of human Histone H4 (P62805). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG | Uniprot ID | P62805 |
Uniprot Id
P62805
Target Species
Human
Target Name
H4C1
Target Full Name
Histone H4
Target Function
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Target Involvement
Chromosomal aberrations involving HISTONE H4 is a cause of B-cell non-Hodgkin lymphomas (B-cell NHL). Translocation t(3;6)(q27;p21), with BCL6.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Histone H4 family
Target Research Area
Others
Target Synonyms
dJ160A22.1; dJ160A22.2; dJ221C16.1; dJ221C16.9; FO108; H4; H4.k; H4/a; H4/b; H4/c; H4/d; H4/e; H4/g; H4/h; H4/I; H4/j; H4/k; H4/m; H4/n; H4/p; H4_HUMAN; H4F2; H4F2iii; H4F2iv; H4FA; H4FB; H4FC; H4FD; H4FE; H4FG; H4FH; H4FI; H4FJ; H4FK; H4FM; H4FN; H4M; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4; HIST2H4A; Hist4h4; Histone 1 H4a; Histone 1 H4b; Histone 1 H4c; Histone 1 H4d; Histone 1 H4e; Histone 1 H4f; Histone 1 H4h; Histone 1 H4i; Histone 1 H4j; Histone 1 H4k; Histone 1 H4l; Histone 2 H4a; histone 4 H4; Histone H4; MGC24116
Target Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.
Notification