Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACSM3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 28-130 of human ACSM3(NP_005613.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ACSM3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 28-130 of human ACSM3(NP_005613.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08407A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACSM3 |
| Target Synonyms | SA; SAH; ACSM3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 28-130 of human ACSM3(NP_005613.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRV | Uniprot ID | Q53FZ2 |
Uniprot Id
Q53FZ2
Target Species
Human
Target Name
ACSM3
Target Full Name
Acyl-coenzyme A synthetase ACSM3, mitochondrial
Target Function
Catalyzes the activation of fatty acids by CoA to produce an acyl-CoA, the first step in fatty acid metabolism. Capable of activating medium-chain fatty acids with a preference for isobutyrate among fatty acids with 2-6 carbon atoms.
Target Subcellular Location
Mitochondrion. Mitochondrion matrix.
Target Protein Families
ATP-dependent AMP-binding enzyme family
Target Synonyms
ACSM3; ACSM3_HUMAN; Acyl CoA synthetase medium chain family member 3; Acyl-CoA synthetase medium-chain family member 3; Acyl-coenzyme A synthetase ACSM3; Acyl-coenzyme A synthetase ACSM3; mitochondrial; Butyrate CoA ligase 3; Butyrate--CoA ligase 3; Butyryl coenzyme A synthetase 3; Butyryl-coenzyme A synthetase 3; Middle chain acyl CoA synthetase 3; Middle-chain acyl-CoA synthetase 3; mitochondrial; Protein SA homolog; SA (rat hypertension associated) homolog; SA; SA hypertension associated homolog; SA; rat; homolog of; SAH
Target Background
Enables butyrate-CoA ligase activity. Predicted to be involved in acyl-CoA metabolic process and fatty acid biosynthetic process. Located in mitochondrion. Implicated in IgA glomerulonephritis. Biomarker of ulcerative colitis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
