Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACSM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 27-130 of human ACSM5 (NP_001311300.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ACSM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 27-130 of human ACSM5 (NP_001311300.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08301A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACSM5 |
| Target Synonyms | Acsm5; ACSM5; MACS3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T-ACSM5-His(C) | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 27-130 of human ACSM5 (NP_001311300.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APLPVPQKIVATWEAISLGRQLVPEYFNFAHDVLDVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMMLVLPRLPEWWL | Uniprot ID | Q6NUN0 |
Uniprot Id
Q6NUN0
Target Species
Human
Target Name
ACSM5
Target Full Name
Acyl-coenzyme A synthetase ACSM5, mitochondrial
Target Function
Catalyzes the activation of fatty acids by CoA to produce an acyl-CoA, the first step in fatty acid metabolism.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
ATP-dependent AMP-binding enzyme family
Target Tissue Specificity
Detected in kidney and liver.
Target Synonyms
Acsm5; ACSM5_HUMAN; Acyl CoA synthetase medium chain family member 5; Acyl coenzyme A synthetase ACSM5; mitochondrial ; Acyl-coenzyme A synthetase ACSM5; FLJ20581; MACS3 ; mitochondrial
Target Background
Predicted to enable fatty acid ligase activity and fatty-acyl-CoA synthase activity. Predicted to be involved in acyl-CoA metabolic process and fatty acid biosynthetic process. Predicted to be active in mitochondrial matrix.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
