-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACTR1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 187-376 of human ACTR1A (NP_005727.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ACTR1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 187-376 of human ACTR1A (NP_005727.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02987A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACTR1A |
| Target Synonyms | ARP1; Arp1A; CTRN1; ACTR1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, MCF7, Mouse lung, Mouse skeletal muscle, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 187-376 of human ACTR1A (NP_005727.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF | Uniprot ID | P61163 |
Uniprot Id
P61163
Target Species
Human
Target Name
ACTR1A
Target Full Name
Alpha-centractin
Target Function
Component of a multi-subunit complex involved in microtubule based vesicle motility. It is associated with the centrosome.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cell cortex.
Target Protein Families
Actin family, ARP1 subfamily
Target Synonyms
Actin related protein 1; Actin RPV; Actin-RPV; ACTR 1A; Actr1a; ACTZ_HUMAN; Alpha centractin; Alpha-centractin; ARP 1; ARP1 actin related protein 1 homolog A; ARP1 actin related protein 1 homolog A centractin alpha; ARP1; ARP1 yeast homolog A; Centractin alpha; Centractin; Centrosome associated actin homolog; Centrosome-associated actin homolog; CTRN 1; CTRN1; FLJ52695; FLJ52800; FLJ55002
Target Background
This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.
Notification