-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADAMTS7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1600-1686 of human ADAMTS7 (NP_055087.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADAMTS7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1600-1686 of human ADAMTS7 (NP_055087.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11428A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADAMTS7 |
| Target Synonyms | ADAM-TS7; ADAMTS-7; ADAM-TS 7; ADAMTS7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1600-1686 of human ADAMTS7 (NP_055087.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR | Uniprot ID | Q9UKP4 |
Uniprot Id
Q9UKP4
Target Species
Human
Target Name
ADAMTS7
Target Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 7
Target Function
Metalloprotease that may play a role in the degradation of COMP.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Tissue Specificity
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Detected in meniscus, bone, tendon, cartilage, synovium, fat and ligaments.
Target Research Area
Cell Biology
Target Synonyms
A disintegrin and metalloprotease with thrombospondin motifs 7 preproprotein; A disintegrin and metalloproteinase with thrombospondin motifs 7; A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 7; A disintegrin like and metalloprotease with thrombospondin type 1 motif 7; ADAM metallopeptidase with thrombospondin type 1 motif 7; ADAM metallopeptidase with thrombospondin type 1 motif 7 preproprotein; ADAM TS 7; ADAM TS7; ADAM-TS 7; ADAM-TS7; ADAMTS 7; ADAMTS-7; Adamts7; ATS7_HUMAN; COMPase; DKFZp434H204
Target Background
The protein encoded by this gene is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) family. Members of this family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs and may regulate vascular smooth muscle cell (VSMC) migration. Mutations in this gene may be associated with susceptibility to coronary artery disease.
Notification