-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADCY3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ADCY3 (NP_004027.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADCY3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ADCY3 (NP_004027.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01901A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADCY3 |
| Target Synonyms | AC3; AC-III; BMIQ19; ADCY3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, MCF7, Mouse brain, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ADCY3 (NP_004027.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLV | Uniprot ID | O60266 |
Uniprot Id
O60266
Target Species
Human
Target Name
ADCY3
Target Full Name
Adenylate cyclase type 3
Target Function
Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling. Participates in signaling cascades triggered by odorant receptors via its function in cAMP biosynthesis. Required for the perception of odorants. Required for normal sperm motility and normal male fertility. Plays a role in regulating insulin levels and body fat accumulation in response to a high fat diet.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Cell projection, cilium. Golgi apparatus.
Target Protein Families
Adenylyl cyclase class-4/guanylyl cyclase family
Target Tissue Specificity
Detected in zona glomerulosa and zona fasciculata in the adrenal gland (at protein level). Expressed in brain, heart, kidney, liver, lung, pancreas islets, placenta, and skeletal muscle. Detected in testis.
Target Research Area
Cancer
Target Synonyms
AC-III; AC3; ADCY3; ADCY3_HUMAN; adenylate cyclase 3; Adenylate cyclase; Adenylate cyclase type 3; Adenylate cyclase type III; Adenylyl cyclase 3; ATP pyrophosphate lyase; ATP pyrophosphate-lyase 3; olfactive type
Target Background
This gene encodes adenylyl cyclase 3 which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This protein appears to be widely expressed in various human tissues and may be involved in a number of physiological and pathophysiological metabolic processes. Two transcript variants encoding different isoforms have been found for this gene.
Notification