-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AGO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human AGO1 (NP_036331.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AGO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human AGO1 (NP_036331.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09618A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AGO1 |
| Target Synonyms | Q99; EIF2C; hAgo1; EIF2C1; GERP95; NEDLBAS; AGO1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7, Mouse lung, Mouse spleen, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human AGO1 (NP_036331.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASM | Uniprot ID | Q9UL18 |
Uniprot Id
Q9UL18
Target Species
Human
Target Name
AGO1
Target Full Name
Protein argonaute-1
Target Function
Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them. Lacks endonuclease activity and does not appear to cleave target mRNAs. Also required for transcriptional gene silencing (TGS) of promoter regions which are complementary to bound short antigene RNAs (agRNAs).
Target Subcellular Location
Cytoplasm, P-body.
Target Protein Families
Argonaute family, Ago subfamily
Target Synonyms
AGO1; AGO1_HUMAN; Argonaute 1; Argonaute 1 RISC catalytic component; Argonaute1; eIF 2C 1; eIF-2C 1; eIF2C 1; EIF2C; Eif2c1; Eukaryotic translation initiation factor 2C 1; GERP95; Golgi Endoplasmic Reticulum protein 95 kDa; hAgo1; Protein argonaute 1; Protein argonaute-1; Putative RNA binding protein Q99; Putative RNA-binding protein Q99; Q99
Target Background
This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.
Notification