-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AGPAT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 145-310 of human AGPAT3 (NP_064517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AGPAT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 145-310 of human AGPAT3 (NP_064517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05658A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AGPAT3 |
| Target Synonyms | LPAAT3; LPLAT3; 1-AGPAT 3; LPAAT-GAMMA1; AGPAT3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, A-549, LO2, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 145-310 of human AGPAT3 (NP_064517.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFPLEDIPLDEKEAAQWLHKLYQEKDALQEIYNQKGMFPGEQFKPARRPWTLLN | Uniprot ID | Q9NRZ7 |
Uniprot Id
Q9NRZ7
Target Species
Human
Target Name
AGPAT3
Target Full Name
1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
Target Function
Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Acts on LPA containing saturated or unsaturated fatty acids C16:0-C20:4 at the sn-1 position using C18:1, C20:4 or C18:2-CoA as the acyl donor. Also acts on lysophosphatidylcholine, lysophosphatidylinositol and lysophosphatidylserine using C18:1 or C20:4-CoA. Has a preference for arachidonoyl-CoA as a donor. Has also a modest lysophosphatidylinositol acyltransferase (LPIAT) activity, converts lysophosphatidylinositol (LPI) into phosphatidylinositol.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus envelope.
Target Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Target Tissue Specificity
Widely expressed with highest levels in testis, pancreas and kidney, followed by spleen, lung, adipose tissue and liver.
Target Synonyms
AGPAT3; LPAAT3; UNQ759/PRO1490; 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma; 1-acylglycerol-3-phosphate O-acyltransferase 3; 1-AGP acyltransferase 3; 1-AGPAT 3; Lysophosphatidic acid acyltransferase gamma; LPAAT-gamma
Target Background
The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene.
Notification