-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AGR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AGR2 (O95994) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AGR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AGR2 (O95994) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13780A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AGR2 |
| Target Synonyms | AG2; AG-2; HPC8; GOB-4; HAG-2; RIFTD; XAG-2; PDIA17; HEL-S-116; AGR2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AGR2 (O95994). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKL | Uniprot ID | O95994 |
Uniprot Id
O95994
Target Species
Human
Target Name
AGR2
Target Full Name
Anterior gradient protein 2 homolog
Target Function
Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion.
Target Subcellular Location
Secreted. Endoplasmic reticulum.
Target Protein Families
AGR family
Target Tissue Specificity
Expressed strongly in trachea, lung, stomach, colon, prostate and small intestine. Expressed weakly in pituitary gland, salivary gland, mammary gland, bladder, appendix, ovary, fetal lung, uterus, pancreas, kidney, fetal kidney, testis, placenta, thyroid
Target Synonyms
AG 2; AG 2 protein; AG-2; AG2; AG2 protein; AGR 2; AGR2; AGR2_HUMAN; Anterior gradient 2 homolog (Xenopus laevis); anterior gradient 2 homolog; Anterior gradient 2; protein disulphide isomerase family member; Anterior gradient 2; Xenopus; homolog of; Anterior gradient homolog 2; Anterior gradient protein 2 homolog; Epididymis secretory protein Li 116; GOB 4; GOB4; HAG 2; hAG-2; hAG2; HAG2/R; HEL S 116; HPC 8; hPC8; PDIA17; Protein disulfide isomerase family A member 17; secreted cement gland homolog; Secreted cement gland protein XAG 2 homolog; Secreted cement gland protein XAG-2 homolog; Secreted cement gland protein XAG2 homolog; XAG 2; XAG2
Target Background
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression.
Notification