-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALDH7A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ALDH7A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08952A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALDH7A1 |
| Target Synonyms | EPD; PDE; ATQ1; ALDH7A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Hep G2, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ | Uniprot ID | P49419 |
Uniprot Id
P49419
Target Species
Human
Target Name
ALDH7A1
Target Full Name
Alpha-aminoadipic semialdehyde dehydrogenase
Target Function
Multifunctional enzyme mediating important protective effects. Metabolizes betaine aldehyde to betaine, an important cellular osmolyte and methyl donor. Protects cells from oxidative stress by metabolizing a number of lipid peroxidation-derived aldehydes. Involved in lysine catabolism.
Target Involvement
Pyridoxine-dependent epilepsy (PDE)
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.; [Isoform 1]: Mitochondrion.
Target Protein Families
Aldehyde dehydrogenase family
Target Tissue Specificity
Abundant in hepatoma cells and fetal cochlea, ovary, eye, heart, adrenal gland, liver and kidney. Low levels present in adult peripheral blood leukocytes and fetal brain, thymus, spleen, skeletal muscle, lung and tongue.
Target Synonyms
26g turgor protein homolog; AL7A1_HUMAN; Aldehyde dehydrogenase 7 A1; Aldehyde dehydrogenase 7 family, member A1; Aldehyde dehydrogenase family 7 member A1; ALDH7A1; Alpha AASA dehydrogenase; Alpha aminoadipic semialdehyde dehydrogenase; Alpha-AASA dehydrogenase; Alpha-aminoadipic semialdehyde dehydrogenase; Antiquitin 1; Antiquitin; Antiquitin-1; ATQ1; Betaine aldehyde dehydrogenase; Delta1 piperideine 6 carboxylate dehydrogenease; Delta1-piperideine-6-carboxylate dehydrogenase; EPD; P6c dehydrogenase; PDE
Target Background
The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.
Notification