Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALG9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 439-618 of human ALG9 (NP_079016.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ALG9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 439-618 of human ALG9 (NP_079016.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02150A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALG9 |
| Target Synonyms | CDG1L; DIBD1; GIKANIS; LOH11CR1J; ALG9 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, BxPC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 439-618 of human ALG9 (NP_079016.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKLLRAFYVPFLSDQYTVYVNYTILKPRKAKQIRKKSGG | Uniprot ID | Q9H6U8 |
Uniprot Id
Q9H6U8
Target Species
Human
Target Name
ALG9
Target Full Name
Alpha-1,2-mannosyltransferase ALG9
Target Function
Catalyzes the transfer of mannose from Dol-P-Man to lipid-linked oligosaccharides.
Target Involvement
Congenital disorder of glycosylation 1L (CDG1L); Gillessen-Kaesbach-Nishimura syndrome (GIKANIS)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Glycosyltransferase 22 family
Target Tissue Specificity
Ubiquitously expressed; with highest levels in heart, liver and pancreas.
Target Synonyms
ALG9; ALG9_HUMAN; Alpha-1,2-mannosyltransferase ALG9; Asparagine-linked glycosylation protein 9 homolog; Disrupted in bipolar disorder protein 1
Target Background
This gene encodes an alpha-1, 2-mannosyltransferase enzyme that functions in lipid-linked oligosaccharide assembly. Mutations in this gene result in congenital disorder of glycosylation type Il. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
