-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALKBH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 290-389 of human ALKBH1 (NP_006011.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ALKBH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 290-389 of human ALKBH1 (NP_006011.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14907A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALKBH1 |
| Target Synonyms | ABH; ABH1; alkB; hABH; ALKBH; ALKBH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A549, BxPC-3, K-562 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 290-389 of human ALKBH1 (NP_006011.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPDS | Uniprot ID | Q13686 |
Uniprot Id
Q13686
Target Species
Human
Target Name
ALKBH1
Target Full Name
Nucleic acid dioxygenase ALKBH1
Target Function
Dioxygenase that acts as on nucleic acids, such as DNA and tRNA. Requires molecular oxygen, alpha-ketoglutarate and iron. A number of activities have been described for this dioxygenase, but recent results suggest that it mainly acts as on tRNAs and mediates their demethylation or oxidation depending on the context and subcellular compartment. Mainly acts as a tRNA demethylase by removing N(1)-methyladenine from various tRNAs, with a preference for N(1)-methyladenine at position 58 (m1A58) present on a stem loop structure of tRNAs. Acts as a regulator of translation initiation and elongation in response to glucose deprivation: regulates both translation initiation, by mediating demethylation of tRNA(Met), and translation elongation, N(1)-methyladenine-containing tRNAs being preferentially recruited to polysomes to promote translation elongation. In mitochondrion, specifically interacts with mt-tRNA(Met) and mediates oxidation of mt-tRNA(Met) methylated at cytosine(34) to form 5-formylcytosine (f(5)c) at this position. mt-tRNA(Met) containing the f(5)c modification at the wobble position enables recognition of the AUA codon in addition to the AUG codon, expanding codon recognition in mitochondrial translation. Specifically demethylates DNA methylated on the 6th position of adenine (N(6)-methyladenosine) DNA. N(6)-methyladenosine (m6A) DNA is present at some L1 elements in embryonic stem cells and probably promotes their silencing. Demethylates mRNAs containing N(3)-methylcytidine modification. Also able to repair alkylated single-stranded DNA by oxidative demethylation, but with low activity. Also has DNA lyase activity and introduces double-stranded breaks at abasic sites: cleaves both single-stranded DNA and double-stranded DNA at abasic sites, with the greatest activity towards double-stranded DNA with two abasic sites. DNA lyase activity does not require alpha-ketboglutarate and iron and leads to the formation of an irreversible covalent protein-DNA adduct with the 5' DNA product. DNA lyase activity is not required during base excision repair and class switch recombination of the immunoglobulin heavy chain during B lymphocyte activation. May play a role in placental trophoblast lineage differentiation.
Target Subcellular Location
Nucleus. Mitochondrion.
Target Protein Families
AlkB family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
ABH; ABH1; alkB; alkB homolog 1 histone H2A dioxygenase; AlkB; alkylation repair homolog 1 (E. coli); ALKB1_HUMAN; ALKBH; ALKBH1; Alkylated DNA repair protein alkB homolog 1; Alkylation repair homolog 1; Alkylation repair; alkB homolog; Alpha-ketoglutarate-dependent dioxygenase ABH1; DNA lyase ABH1; DNA oxidative demethylase ALKBH1; hABH
Target Background
This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.
Notification