Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AMOTL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 810-900 of human AMOTL1 (NP_570899.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AMOTL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 810-900 of human AMOTL1 (NP_570899.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07199A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AMOTL1 |
| Target Synonyms | JEAP; AMOTL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, MCF7, Mouse brain, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 810-900 of human AMOTL1 (NP_570899.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTSSQLAEEKKEEKTWKGSIGLLLGKEHHEHASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLS | Uniprot ID | Q8IY63 |
Uniprot Id
Q8IY63
Target Species
Human
Target Name
AMOTL1
Target Full Name
Angiomotin-like protein 1
Target Function
Inhibits the Wnt/beta-catenin signaling pathway, probably by recruiting CTNNB1 to recycling endosomes and hence preventing its translocation to the nucleus.
Target Subcellular Location
Cell junction, tight junction.
Target Protein Families
Angiomotin family
Target Synonyms
2310010G08Rik; 2310067L22Rik; 4932416D09Rik; AMOL1_HUMAN; Amotl1; Angiomotin-like protein 1; FLJ00155; JEAP; Junction enriched and associated protein; mFLJ00155
Target Background
The protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
