Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AMPD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AMPD1 (P23109) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AMPD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AMPD1 (P23109) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01894A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AMPD1 |
| Target Synonyms | MAD; MADA; MMDD; AMPD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Mouse pancreas, Mouse skeletal muscle, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AMPD1 (P23109). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNVRIFYSVSQSPHSLLSLLFYCAILESRISATMPLFKLPAEEKQIDDAMRNFAEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTS | Uniprot ID | P23109 |
Uniprot Id
P23109
Target Species
Human
Target Name
AMPD1
Target Full Name
AMP deaminase 1
Target Function
AMP deaminase plays a critical role in energy metabolism.
Target Involvement
Myopathy due to myoadenylate deaminase deficiency (MMDD)
Target Protein Families
Metallo-dependent hydrolases superfamily, Adenosine and AMP deaminases family
Target Synonyms
AMPD1AMP deaminase 1; EC 3.5.4.6; AMP deaminase isoform M; Myoadenylate deaminase
Target Background
Adenosine monophosphate deaminase 1 catalyzes the deamination of AMP to IMP in skeletal muscle and plays an important role in the purine nucleotide cycle. Two other genes have been identified, AMPD2 and AMPD3, for the liver- and erythocyte-specific isoforms, respectively. Deficiency of the muscle-specific enzyme is apparently a common cause of exercise-induced myopathy and probably the most common cause of metabolic myopathy in the human. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
