-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANAPC7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ANAPC7 (NP_057322.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ANAPC7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ANAPC7 (NP_057322.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01963A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANAPC7 |
| Target Synonyms | APC7; FERBON; ANAPC7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ANAPC7 (NP_057322.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLK | Uniprot ID | Q9UJX3 |
Uniprot Id
Q9UJX3
Target Species
Human
Target Name
ANAPC7
Target Full Name
Anaphase-promoting complex subunit 7
Target Function
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
Target Subcellular Location
Cytoplasm, cytoskeleton. Nucleus. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
APC7 family
Target Synonyms
anapc7; Anaphase promoting complex subunit 7; Anaphase-promoting complex subunit 7; APC 7; APC7; APC7_HUMAN; Cyclosome subunit 7; Prediabetic NOD sera reactive autoantigen
Target Background
This gene encodes a tetratricopeptide repeat containing component of the anaphase promoting complex/cyclosome (APC/C), a large E3 ubiquitin ligase that controls cell cycle progression by targeting a number of cell cycle regulators such as B-type cyclins for 26S proteasome-mediated degradation through ubiquitination. The encoded protein is required for proper protein ubiquitination function of APC/C and for the interaction of APC/C with certain transcription coactivators. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification