-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANP32E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ANP32E (NP_112182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ANP32E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ANP32E (NP_112182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09240A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANP32E |
| Target Synonyms | LANPL; LANP-L; ANP32E | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ANP32E (NP_112182.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLE | Uniprot ID | Q9BTT0 |
Uniprot Id
Q9BTT0
Target Species
Human
Target Name
ANP32E
Target Full Name
Acidic leucine-rich nuclear phosphoprotein 32 family member E
Target Function
Histone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AZ1 from the nucleosome: removes H2A.Z/H2AZ1 from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AZ1 in the nucleosome. May stabilize the evicted H2A.Z/H2AZ1-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state. Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
ANP32 family
Target Tissue Specificity
Expressed in peripheral blood leukocytes, colon, small intestine, prostate, thymus, spleen, skeletal muscle, liver and kidney.
Target Synonyms
Acidic (leucine rich) nuclear phosphoprotein 32 family member E; Acidic leucine-rich nuclear phosphoprotein 32 family member E; AN32E_HUMAN; anp32e; Cerebellar postnatal development protein 1; LANP like protein; LANP-L; LANP-like protein; LANPL; Leucine rich acidic nuclear protein like; MGC5350
Target Background
Enables histone binding activity. Involved in histone exchange. Located in nucleus. Part of Swr1 complex.
Notification