-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APPBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 386-585 of human APPBP2 (NP_006371.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against APPBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 386-585 of human APPBP2 (NP_006371.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04841A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APPBP2 |
| Target Synonyms | PAT1; APP-BP2; HS.84084; APPBP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, A-431, Jurkat, Mouse brain, Raji, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 386-585 of human APPBP2 (NP_006371.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKAFGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQNVEGPSC | Uniprot ID | Q92624 |
Uniprot Id
Q92624
Target Species
Human
Target Name
APPBP2
Target Full Name
Amyloid protein-binding protein 2
Target Function
Substrate-recognition component of a Cul2-RING (CRL2) E3 ubiquitin-protein ligase complex of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation. The C-degron recognized by the DesCEND pathway is usually a motif of less than ten residues and can be present in full-length proteins, truncated proteins or proteolytically cleaved forms. The CRL2(APPBP2) complex specifically recognizes proteins with a -Arg-Xaa-Xaa-Gly degron at the C-terminus, leading to their ubiquitination and degradation. The CRL2(APPBP2) complex mediates ubiquitination and degradation of truncated SELENOV selenoproteins produced by failed UGA/Sec decoding, which end with a -Arg-Xaa-Xaa-Gly degron. May play a role in intracellular protein transport: may be involved in the translocation of APP along microtubules toward the cell surface.
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton. Membrane; Peripheral membrane protein.
Target Synonyms
amyloid beta precursor protein (cytoplasmic tail) binding protein 2; Amyloid beta precursor protein-binding protein 2; Amyloid protein binding protein 2; Amyloid protein-binding protein 2; APBP2_HUMAN; APP BP2; APP-BP2; Appbp2; PAT1; Protein interacting with APP tail 1
Target Background
The protein encoded by this gene interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. The encoded protein may be involved in regulating cell death. This gene has been found to be highly expressed in breast cancer. Alternative splicing results in multiple transcript variants.
Notification