Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARL11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human ARL11 (NP_612459.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARL11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human ARL11 (NP_612459.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03539A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARL11 |
| Target Synonyms | ARLTS1; ARL11 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human ARL11 (NP_612459.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS | Uniprot ID | Q969Q4 |
Uniprot Id
Q969Q4
Target Species
Human
Target Name
ARL11
Target Full Name
ADP-ribosylation factor-like protein 11
Target Function
May play a role in apoptosis. May act as a tumor suppressor.
Target Involvement
Leukemia, chronic lymphocytic (CLL)
Target Protein Families
Small GTPase superfamily, Arf family
Target Tissue Specificity
Expressed in lung and leukocytes.
Target Synonyms
ADP ribosylation factor like 11; ADP ribosylation factor like protein 11; ADP ribosylation factor like tumor suppressor protein 1; ADP-ribosylation factor-like protein 11; ADP-ribosylation factor-like tumor suppressor protein 1; ARL11; ARL11_HUMAN; ARLTS1
Target Background
This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
