-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASCC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ASCC1 (NP_001185727.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ASCC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ASCC1 (NP_001185727.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04803A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASCC1 |
| Target Synonyms | p50; CGI-18; SMABF2; ASC1p50; ASCC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ASCC1 (NP_001185727.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEVLRPQLIRIDGRNYRKNPVQEQTYQHEEDEEDFYQGSMECADEPCDAYEVEQTPQGFRSTLRAPSLLYKHIVGKRGDTRKKIEMETKTSISIPKPGQDGEIVITGQHRNGVISARTRIDVLLDTFRRKQPFTHFLAFFLNEVEVQEGFLRFQEEVLAKCSMDHGVDSSIFQNPKKLHL | Uniprot ID | Q8N9N2 |
Uniprot Id
Q8N9N2
Target Species
Human
Target Name
ASCC1
Target Full Name
Activating signal cointegrator 1 complex subunit 1
Target Function
Plays a role in DNA damage repair as component of the ASCC complex. Part of the ASC-1 complex that enhances NF-kappa-B, SRF and AP1 transactivation. In cells responding to gastrin-activated paracrine signals, it is involved in the induction of SERPINB2 expression by gastrin. May also play a role in the development of neuromuscular junction.
Target Involvement
Barrett esophagus (BE); Spinal muscular atrophy with congenital bone fractures 2 (SMABF2)
Target Subcellular Location
Nucleus. Nucleus speckle.
Target Tissue Specificity
Ubiquitous.
Target Research Area
Signal Transduction
Target Synonyms
Activating signal cointegrator 1 complex subunit 1; ASC-1 complex subunit p50; ASC1 complex subunit p50 ; ASC1p50; ASCC1; ASCC1_HUMAN; CGI 18; RP11-150D20.4; Trip4 complex subunit p50
Target Background
This gene encodes a subunit of the activating signal cointegrator 1 (ASC-1) complex. The ASC-1 complex is a transcriptional coactivator that plays an important role in gene transactivation by multiple transcription factors including activating protein 1 (AP-1), nuclear factor kappa-B (NF-kB) and serum response factor (SRF). The encoded protein contains an N-terminal KH-type RNA-binding motif which is required for AP-1 transactivation by the ASC-1 complex. Mutations in this gene are associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene.
Notification