-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASGR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ASGR1 (NP_001662.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ASGR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ASGR1 (NP_001662.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09420A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASGR1 |
| Target Synonyms | HL-1; ASGPR; ASGPR1; CLEC4H1; ASGR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse liver, Rat liver, THP-1(Negative control) | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ASGR1 (NP_001662.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSE | Uniprot ID | P07306 |
Uniprot Id
P07306
Target Species
Human
Target Name
ASGR1
Target Full Name
Asialoglycoprotein receptor 1
Target Function
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
Target Subcellular Location
[Isoform H1a]: Membrane; Single-pass type II membrane protein.; [Isoform H1b]: Secreted.
Target Tissue Specificity
Expressed exclusively in hepatic parenchymal cells.
Target Research Area
Signal Transduction
Target Synonyms
ASGP-R 1; ASGPR 1; ASGPR; ASGPR1; Asgr1; ASGR1_HUMAN; Asialoglycoprotein receptor 1; C type lectin domain family 4 member H1; C-type lectin domain family 4 member H1; CLEC4H1; Hepatic lectin H1; HL-1
Target Background
This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the more abundant major subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification