-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 289-398 of human ATG4A (NP_443168.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATG4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 289-398 of human ATG4A (NP_443168.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14626A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG4A |
| Target Synonyms | APG4A; AUTL2; HsAPG4A; ATG4A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 289-398 of human ATG4A (NP_443168.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV | Uniprot ID | Q8WYN0 |
Uniprot Id
Q8WYN0
Target Species
Human
Target Name
ATG4A
Target Full Name
Cysteine protease ATG4A
Target Function
Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Cleaves the C-terminal amino acid of ATG8 family proteins to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. Preferred substrate is GABARAPL2 followed by MAP1LC3A and GABARAP. Has also an activity of delipidating enzyme for the PE-conjugated forms.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Peptidase C54 family
Target Synonyms
AI627006; APG4 autophagy 4 homolog A; Apg4a; ATG4 autophagy related 4 homolog A (S. cerevisiae); ATG4 autophagy related 4 homolog A; ATG4A; ATG4A_HUMAN; Atg4al; AUT like 2 cysteine endopeptidase; AUT-like 2 cysteine endopeptidase; Autl2; Autophagin 2; Autophagin-2; Autophagy related 4A cysteine peptidase; Autophagy related cysteine endopeptidase 2; Autophagy related protein 4 homolog A; Autophagy-related cysteine endopeptidase 2; Autophagy-related protein 4 homolog A; AV169859; Cysteine protease ATG4A; hAPG4A; MGC107179
Target Background
Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases.
Notification