Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP1A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ATP1A4 (NP_653300.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATP1A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ATP1A4 (NP_653300.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05181A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP1A4 |
| Target Synonyms | ATP1A1; ATP1AL2; ATP1A4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain, Mouse testis, Rat kidney, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ATP1A4 (NP_653300.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELSTKYSVDLTKGHSHQRAKEILTRGGPNTVTP | Uniprot ID | Q13733 |
Uniprot Id
Q13733
Target Species
Human
Target Name
ATP1A4
Target Full Name
Sodium/potassium-transporting ATPase subunit alpha-4
Target Function
This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients. Plays a role in sperm motility.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=In mature sperm, located in the principle piece of the sperm flagellum.
Target Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IIC subfamily
Target Tissue Specificity
Specifically expressed in testis. Found in very low levels in skeletal muscle. Expressed in mature sperm (at protein level).
Target Synonyms
ATP1A4; ATP1AL2Sodium/potassium-transporting ATPase subunit alpha-4; Na(+)/K(+) ATPase alpha-4 subunit; EC 7.2.2.13; Sodium pump subunit alpha-4
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
