Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP6V0C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP6V0C (NP_001185498.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ATP6V0C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP6V0C (NP_001185498.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10783A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP6V0C |
| Target Synonyms | ATPL; VATL; VPPC; Vma3; ATP6C; ATP6L; ATP6V0C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP6V0C (NP_001185498.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVG | Uniprot ID | P27449 |
Uniprot Id
P27449
Target Species
Human
Target Name
ATP6V0C
Target Full Name
V-type proton ATPase 16 kDa proteolipid subunit c
Target Function
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Target Subcellular Location
Vacuole membrane; Multi-pass membrane protein.
Target Protein Families
V-ATPase proteolipid subunit family
Target Synonyms
ATP6V0C; ATP6C; ATP6L; ATPL; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
